PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.1920s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 248aa    MW: 26889.9 Da    PI: 9.1502
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.1920s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.75.1e-383697263
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                         +e++l+cprCdstntkfCyynnyslsqPryfCk+CrryWtkGG lrn+P+Gg+ rk+k+sss
  Araha.1920s0001.1.p 36 PEQSLRCPRCDSTNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGILRNIPIGGAYRKHKRSSS 97
                         67899*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-303694IPR003851Zinc finger, Dof-type
PfamPF027016.5E-333894IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.4074094IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104278IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MDYSAMHQNV VGVSSCSSQD FQNQKKPSSA TRPAPPEQSL RCPRCDSTNT KFCYYNNYSL  60
SQPRYFCKSC RRYWTKGGIL RNIPIGGAYR KHKRSSSATK SLRTTPEPTA SHDARTFSTA  120
GFGGYNNNIS NEQMELGLAF ALLNKQPLGV SSHLGFGSSQ SPMVMDGVYG TTSQQMENAG  180
YAFGNGGGGL EQMATSDPNK VLWGFPWQMN MGGGSGHSHG HGHVDQIDSG REIWSSTVNY  240
INTGALL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00392DAPTransfer from AT3G45610Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2430330.0AJ243033.1 Arabidopsis thaliana mRNA for dof zinc finger protein (dof6 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010514888.11e-163PREDICTED: dof zinc finger protein DOF3.2-like
SwissprotQ9M1E61e-157DOF32_ARATH; Dof zinc finger protein DOF3.2
TrEMBLD7LMP51e-161D7LMP5_ARALL; Dof-type zinc finger domain-containing protein
STRINGfgenesh2_kg.5__937__AT3G45610.11e-161(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61321845
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G45610.11e-153Dof family protein